PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG391200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 253aa    MW: 27268.3 Da    PI: 9.8379
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG391200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.39.3e-5822117297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk yl+k+r
  Pavir.9KG391200.1.p  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKHYLHKFR 111
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+ege+
  Pavir.9KG391200.1.p 112 EIEGER 117
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.3E-5519149IPR009072Histone-fold
SuperFamilySSF471131.33E-4024129IPR009072Histone-fold
PfamPF008089.1E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-205573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.0E-207492No hitNo description
PRINTSPR006152.0E-2093111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MPDSDNDSGG PSNAGGELSS PREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEDYV EPLKHYLHKF REIEGERAAA  120
SSGASGSAAA QQQQGDVARG AANAAGYGAP GAGGMMMMMG QPMYGSPQQQ PPPQQQQQQH  180
QQHHMASGRQ RWLRPSRRRR RLVVVPMYGS PPQQQQQHQQ HHMAMGGRGG YGHQGGGGGS  240
SSSSGLGRQD RA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4722112292Transcription factor HapC (Eurofung)
4g92_B2e-4722112292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.184131e-122root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9560970.0EU956097.1 Zea mays clone 1557377 nuclear transcription factor Y subunit B-3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO233107e-72NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLF8UMZ52e-87F8UMZ5_WHEAT; Transcription factor CBF/NF-YB/HAP3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.19e-71nuclear factor Y, subunit B3